PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00048.116
Common NameAMTR_s00048p00162580, LOC18443887
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 255aa    MW: 28831.6 Da    PI: 9.0412
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00048.116genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.32.3e-17113167256
                                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                               rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  evm_27.model.AmTr_v1.0_scaffold00048.116 113 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKRLKLRPRQVEVWFQNRRARTK 167
                                               778899***********************************************98 PP

2HD-ZIP_I/II1261.6e-40113202191
                               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkra 69 
                                               +kk+rlskeq++ LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr+
  evm_27.model.AmTr_v1.0_scaffold00048.116 113 RKKLRLSKEQSAYLEESFKEHNTLNPKQKLALAKRLKLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRC 181
                                               69******************************************************************* PP

                               HD-ZIP_I/II  70 ydalkeenerLekeveeLreel 91 
                                               +++l+een+rL+ e +eLr +l
  evm_27.model.AmTr_v1.0_scaffold00048.116 182 CETLTEENRRLHMELQELR-AL 202
                                               ******************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-1887170IPR009057Homeodomain-like
SuperFamilySSF466893.04E-18103170IPR009057Homeodomain-like
PROSITE profilePS5007116.876109169IPR001356Homeobox domain
SMARTSM003891.2E-14111173IPR001356Homeobox domain
PfamPF000469.0E-15113167IPR001356Homeobox domain
CDDcd000867.59E-14113170No hitNo description
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
SMARTSM003409.5E-20169212IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-10169203IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MDLALSIGDS TAYAKEITER SWISGLEMTR NFQGKETHSR TLPVQLDLLP LAPFPRSSRP  60
QNTNPIDHGQ IDMNQTPPTS STDYSRAPMS ETEGDRVSCD EGESTGGGEG STRKKLRLSK  120
EQSAYLEESF KEHNTLNPKQ KLALAKRLKL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR  180
CCETLTEENR RLHMELQELR ALKRFSVEKP LHLVFPAASL TVCPSCERFS SPDNGRKTTG  240
KRFLPFAQDT SAAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117TRKKLRL
2161169RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854130.10.0PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotQ8GRL41e-62HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
SwissprotA2XE761e-62HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
TrEMBLU5D2H50.0U5D2H5_AMBTC; Uncharacterized protein
STRINGPOPTR_0001s23680.15e-66(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-46homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]